PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G10030.2
Common NameBZIP57, OBF4, T31P16_20, TGA4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 364aa    MW: 41751.3 Da    PI: 7.1895
Description TGACG motif-binding factor 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G10030.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.31.2e-1178110335
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                  ++k +rr+++NReAAr+sR+RKka++++Le+  
  AT5G10030.2  78 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSR 110
                  6899*************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-676139IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.63478120IPR004827Basic-leucine zipper domain
PfamPF001705.3E-978108IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.39E-780114No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-782108No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
PfamPF141443.5E-30166241IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0005516Molecular Functioncalmodulin binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MNTTSTHFVP PRRFEVYEPL NQIGMWEESF KNNGDMYTPG SIIIPTNEKP DSLSEDTSHG  60
TEGTPHKFDQ EASTSRHPDK IQRRLAQNRE AARKSRLRKK AYVQQLETSR LKLIHLEQEL  120
DRARQQGFYV GNGVDTNALS FSDNMSSGIV AFEMEYGHWV EEQNRQICEL RTVLHGQVSD  180
IELRSLVENA MKHYFQLFRM KSAAAKIDVF YVMSGMWKTS AERFFLWIGG FRPSELLKVL  240
LPHFDPLTDQ QLLDVCNLRQ SCQQAEDALS QGMEKLQHTL AESVAAGKLG EGSYIPQMTC  300
AMERLEALVS FVNQADHLRH ETLQQMHRIL TTRQAARGLL ALGEYFQRLR ALSSSWAARQ  360
REPT
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865217510.0
Genevisible250463_at0.0
Expression AtlasAT5G10030-
AtGenExpressAT5G10030-
ATTED-IIAT5G10030-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:8628224}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of basic leucine zipper transcription gene family. Nomenclature according to Xiang, et al. (1997).
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Function -- GeneRIF ? help Back to Top
  1. OBF4 can regulate flowering expression through the formation of a protein complex with CONSTANS
    [PMID: 18587275]
  2. clade I TGA factors as positive regulators of one or more ER-related secretion pathways
    [PMID: 24086773]
  3. TGA1 and TGA4 as important regulatory factors of the nitrate response in Arabidopsis roots.
    [PMID: 25039575]
  4. Following drought stress there were higher nitrogen and proline contents in transgenic AtTGA4 plants than in wild type controls, and activity of the key enzyme nitrite reductase involved in nitrate assimilation processes was also higher.
    [PMID: 25596127]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G10030.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
IntActSearch Q39162
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G10030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293510.0AK229351.1 Arabidopsis thaliana mRNA for bZip transcription factor OBF4 / AtbZip57, complete cds, clone: RAFL16-60-A10.
GenBankBT0248960.0BT024896.1 Arabidopsis thaliana At5g10030 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190270.10.0transcription factor TGA4
RefseqNP_196565.10.0transcription factor TGA4
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLQ24JJ30.0Q24JJ3_ARATH; At5g10030
STRINGAT5G10030.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Zhou JM, et al.
    NPR1 differentially interacts with members of the TGA/OBF family of transcription factors that bind an element of the PR-1 gene required for induction by salicylic acid.
    Mol. Plant Microbe Interact., 2000. 13(2): p. 191-202
    [PMID:10659709]
  2. Després C,DeLong C,Glaze S,Liu E,Fobert PR
    The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors.
    Plant Cell, 2000. 12(2): p. 279-90
    [PMID:10662863]
  3. Kang HG,Singh KB
    Characterization of salicylic acid-responsive, arabidopsis Dof domain proteins: overexpression of OBP3 leads to growth defects.
    Plant J., 2000. 21(4): p. 329-39
    [PMID:10758484]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Reddy VS,Ali GS,Reddy AS
    Genes encoding calmodulin-binding proteins in the Arabidopsis genome.
    J. Biol. Chem., 2002. 277(12): p. 9840-52
    [PMID:11782485]
  6. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  7. Després C, et al.
    The Arabidopsis NPR1 disease resistance protein is a novel cofactor that confers redox regulation of DNA binding activity to the basic domain/leucine zipper transcription factor TGA1.
    Plant Cell, 2003. 15(9): p. 2181-91
    [PMID:12953119]
  8. Bae MS,Cho EJ,Choi EY,Park OK
    Analysis of the Arabidopsis nuclear proteome and its response to cold stress.
    Plant J., 2003. 36(5): p. 652-63
    [PMID:14617066]
  9. Foley RC,Singh KB
    TGA5 acts as a positive and TGA4 acts as a negative regulator of ocs element activity in Arabidopsis roots in response to defence signals.
    FEBS Lett., 2004. 563(1-3): p. 141-5
    [PMID:15063738]
  10. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  11. Kesarwani M,Yoo J,Dong X
    Genetic interactions of TGA transcription factors in the regulation of pathogenesis-related genes and disease resistance in Arabidopsis.
    Plant Physiol., 2007. 144(1): p. 336-46
    [PMID:17369431]
  12. Song YH, et al.
    Isolation of CONSTANS as a TGA4/OBF4 interacting protein.
    Mol. Cells, 2008. 25(4): p. 559-65
    [PMID:18587275]
  13. Li S, et al.
    Nuclear activity of ROXY1, a glutaredoxin interacting with TGA factors, is required for petal development in Arabidopsis thaliana.
    Plant Cell, 2009. 21(2): p. 429-41
    [PMID:19218396]
  14. Lindermayr C,Sell S,M
    Redox regulation of the NPR1-TGA1 system of Arabidopsis thaliana by nitric oxide.
    Plant Cell, 2010. 22(8): p. 2894-907
    [PMID:20716698]
  15. Shearer HL, et al.
    Arabidopsis clade I TGA transcription factors regulate plant defenses in an NPR1-independent fashion.
    Mol. Plant Microbe Interact., 2012. 25(11): p. 1459-68
    [PMID:22876961]
  16. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  17. Wang L,Fobert PR
    Arabidopsis clade I TGA factors regulate apoplastic defences against the bacterial pathogen Pseudomonas syringae through endoplasmic reticulum-based processes.
    PLoS ONE, 2013. 8(9): p. e77378
    [PMID:24086773]
  18. Alvarez JM, et al.
    Systems approach identifies TGA1 and TGA4 transcription factors as important regulatory components of the nitrate response of Arabidopsis thaliana roots.
    Plant J., 2014. 80(1): p. 1-13
    [PMID:25039575]
  19. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  20. Zhong L, et al.
    AtTGA4, a bZIP transcription factor, confers drought resistance by enhancing nitrate transport and assimilation in Arabidopsis thaliana.
    Biochem. Biophys. Res. Commun., 2015. 457(3): p. 433-9
    [PMID:25596127]
  21. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  22. Zhang B,Foley RC,Singh KB
    Isolation and characterization of two related Arabidopsis ocs-element bZIP binding proteins.
    Plant J., 1993. 4(4): p. 711-6
    [PMID:8252072]
  23. de Pater S,Pham K,Memelink J,Kijne J
    Binding specificity and tissue-specific expression pattern of the Arabidopsis bZIP transcription factor TGA2.
    Mol. Gen. Genet., 1996. 250(2): p. 237-9
    [PMID:8628224]
  24. Zhang B,Chen W,Foley RC,Büttner M,Singh KB
    Interactions between distinct types of DNA binding proteins enhance binding to ocs element promoter sequences.
    Plant Cell, 1995. 7(12): p. 2241-52
    [PMID:8718629]
  25. Büttner M,Singh KB
    Arabidopsis thaliana ethylene-responsive element binding protein (AtEBP), an ethylene-inducible, GCC box DNA-binding protein interacts with an ocs element binding protein.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(11): p. 5961-6
    [PMID:9159183]
  26. Xiang C,Miao Z,Lam E
    DNA-binding properties, genomic organization and expression pattern of TGA6, a new member of the TGA family of bZIP transcription factors in Arabidopsis thaliana.
    Plant Mol. Biol., 1997. 34(3): p. 403-15
    [PMID:9225852]